PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10027890m
Common NameEUTSA_v10027890mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 261aa    MW: 29577.3 Da    PI: 9.6453
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10027890mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57395.36.2e-3052143398
           DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      ++r+w+eeDe+++L+Gl+d+ +k+g++p +d+dafy+f+ +si  k+sk+ql++Kir+LKkKf  +++k+++g+++      d+++  ls++iW
  Thhalv10027890m  52 SNRIWNEEDELTVLKGLVDYLDKEGVQPNSDWDAFYHFLGDSIAEKFSKQQLLSKIRKLKKKFLLHMEKTSQGDDMLC----DSEAIRLSRMIW 141
                      78*******************************************************************999999765....6788******** PP

           DUF573  97 gs 98 
                      g+
  Thhalv10027890m 142 GQ 143
                      96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.2E-2253142IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MAKPKQLDFS DDNSPSTRKS PRKRASNPSP ASETTKKKKK KKKTKKSAPP VSNRIWNEED  60
ELTVLKGLVD YLDKEGVQPN SDWDAFYHFL GDSIAEKFSK QQLLSKIRKL KKKFLLHMEK  120
TSQGDDMLCD SEAIRLSRMI WGQNGSESAN NQSKSFNQDE ALKDNDQVAN AEANENVAAL  180
GDKNTDVDES GTLRDAFESI MSRWLSDHQK KVQLENLMNL EAGKRKELSD EWKELCAEEA  240
RLNIKKFKYS AKFAEAAAKR *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12142RKRASNPSPASETTKKKKKKKK
23642KKKKKKK
33645KKKKKKKTKK
43745KKKKKKTKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00061PBMTransfer from AT4G00270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405926.10.0hypothetical protein EUTSA_v10027890mg
RefseqXP_006405927.10.0hypothetical protein EUTSA_v10027890mg
TrEMBLV4LAC30.0V4LAC3_EUTSA; Uncharacterized protein
STRINGAT4G00270.14e-70(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00270.12e-67DNA-binding storekeeper protein-related transcriptional regulator